Lineage for d1lzqa_ (1lzq A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 671909Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 671925Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 671926Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)
  8. 672266Domain d1lzqa_: 1lzq A: [84741]

Details for d1lzqa_

PDB Entry: 1lzq (more details), 2.2 Å

PDB Description: crystal structure of the complex of mutant hiv-1 protease (a71v, v82t, i84v) with an ethylenamine peptidomimetic inhibitor boc-phe-psi[ch2ch2nh]-phe-glu-phe-nh2
PDB Compounds: (A:) protease retropepsin

SCOP Domain Sequences for d1lzqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lzqa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf

SCOP Domain Coordinates for d1lzqa_:

Click to download the PDB-style file with coordinates for d1lzqa_.
(The format of our PDB-style files is described here.)

Timeline for d1lzqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lzqb_