Lineage for d1lxna_ (1lxn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955711Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2955712Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 2955716Protein Hypothetical protein MTH1187 [89959] (1 species)
  7. 2955717Species Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry)
  8. 2955718Domain d1lxna_: 1lxn A: [84737]
    structural genomics; NESG target TT272
    complexed with so4

Details for d1lxna_

PDB Entry: 1lxn (more details), 2.3 Å

PDB Description: x-ray structure of mth1187 northeast structural genomics consortium target tt272
PDB Compounds: (A:) hypothetical protein mth1187

SCOPe Domain Sequences for d1lxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxna_ d.58.48.1 (A:) Hypothetical protein MTH1187 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

SCOPe Domain Coordinates for d1lxna_:

Click to download the PDB-style file with coordinates for d1lxna_.
(The format of our PDB-style files is described here.)

Timeline for d1lxna_: