![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) ![]() |
![]() | Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
![]() | Protein Hypothetical protein MTH1187 [89959] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry) |
![]() | Domain d1lxna_: 1lxn A: [84737] structural genomics; NESG target TT272 complexed with so4 |
PDB Entry: 1lxn (more details), 2.3 Å
SCOPe Domain Sequences for d1lxna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxna_ d.58.48.1 (A:) Hypothetical protein MTH1187 {Methanobacterium thermoautotrophicum [TaxId: 145262]} mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki
Timeline for d1lxna_: