Lineage for d1lw3a2 (1lw3 A:199-586)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topology
Family c.45.1.3: Myotubularin-like phosphatases [102422] (1 protein)
common fold is decorated with additional structuresProtein Myotubularin-related protein 2, C-terminal domain [102423] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102424] (4 PDB entries) 
Domain d1lw3a2: 1lw3 A:199-586 [91153]
Other proteins in same PDB: d1lw3a1
complexed with po4
Details for d1lw3a2
PDB Entry: 1lw3 (more details), 2.3 Å
PDB Description: crystal structure of myotubularin-related protein 2 complexed with phosphate
PDB Compounds: (A:) Myotubularin-related protein 2SCOPe Domain Sequences for d1lw3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw3a2 c.45.1.3 (A:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnpr
SCOPe Domain Coordinates for d1lw3a2:
Click to download the PDB-style file with coordinates for d1lw3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lw3a2:
- d1lw3a2 first appeared in SCOP 1.67
- d1lw3a2 appears in SCOP 1.75
- d1lw3a2 appears in SCOPe 2.02
- d1lw3a2 appears in the current release, SCOPe 2.08
View in 3D
