Lineage for d1lw3a1 (1lw3 A:74-198)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (12 families) 
Family b.55.1.8: GRAM domain [101839] (1 protein) Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101841] (4 PDB entries) 
Domain d1lw3a1: 1lw3 A:74-198 [91152]
Other proteins in same PDB: d1lw3a2
complexed with po4; mutant
Details for d1lw3a1
PDB Entry: 1lw3 (more details), 2.3 Å
PDB Description: crystal structure of myotubularin-related protein 2 complexed with phosphate
PDB Compounds: (A:) Myotubularin-related protein 2SCOP Domain Sequences for d1lw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lw3a1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvin
rvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplf
afeyk
SCOP Domain Coordinates for d1lw3a1:
Click to download the PDB-style file with coordinates for d1lw3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lw3a1:
- d1lw3a1 first appeared in SCOP 1.67
- d1lw3a1 appears in SCOP 1.71
- d1lw3a1 appears in SCOP 1.75
- d1lw3a1 appears in the current release, SCOPe 2.08
View in 3D
