Lineage for d1lvha_ (1lvh A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848034Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 848035Protein beta-Phosphoglucomutase [75174] (1 species)
  7. 848036Species Lactococcus lactis [TaxId:1358] [75175] (6 PDB entries)
  8. 848044Domain d1lvha_: 1lvh A: [74282]
    phosphorylated enzyme

Details for d1lvha_

PDB Entry: 1lvh (more details), 2.3 Å

PDB Description: the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution
PDB Compounds: (A:) beta-phosphoglucomutase

SCOP Domain Sequences for d1lvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvha_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

SCOP Domain Coordinates for d1lvha_:

Click to download the PDB-style file with coordinates for d1lvha_.
(The format of our PDB-style files is described here.)

Timeline for d1lvha_: