![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (23 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (9 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein beta-Phosphoglucomutase [75174] (1 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [75175] (6 PDB entries) |
![]() | Domain d1lvha_: 1lvh A: [74282] |
PDB Entry: 1lvh (more details), 2.3 Å
SCOP Domain Sequences for d1lvha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lvha_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
Timeline for d1lvha_: