Lineage for d1lvfb_ (1lvf B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.47: STAT-like [47654] (6 superfamilies)
4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelixSuperfamily a.47.2: t-snare proteins [47661] (1 family) 
Family a.47.2.1: t-snare proteins [47662] (6 proteins) 
Protein Syntaxin 6, SNAP-25 homolog [74727] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [74728] (1 PDB entry) 
Domain d1lvfb_: 1lvf B: [74281]
three-helical fragment; similar to one spectrin repeat
missing some secondary structures that made up less than one-third of the common domain
Details for d1lvfb_
PDB Entry: 1lvf (more details), 2.1 Å
PDB Description: syntaxin 6
PDB Compounds: (B:) syntaxin 6SCOPe Domain Sequences for d1lvfb_:
Sequence, based on SEQRES records: (download)
>d1lvfb_ a.47.2.1 (B:) Syntaxin 6, SNAP-25 homolog {Norway rat (Rattus norvegicus) [TaxId: 10116]}
medpffvvkgevqkavntaqglfqrwtellqgpsaatreeidwttnelrnnlrsiewdle
dldetisiveanprkfnldatelsirkafitstrqivrdmkdqmsass
Sequence, based on observed residues (ATOM records): (download)
>d1lvfb_ a.47.2.1 (B:) Syntaxin 6, SNAP-25 homolog {Norway rat (Rattus norvegicus) [TaxId: 10116]}
medpffvvkgevqkavntaqglfqrwtellqgpsaatreeidwttnelrnnlrsiewdle
dldetisiveannldatelsirkafitstrqivrdmkdqmsass
SCOPe Domain Coordinates for d1lvfb_:
Click to download the PDB-style file with coordinates for d1lvfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lvfb_:
- d1lvfb_ first appeared in SCOP 1.61
- d1lvfb_ appears in SCOPe 2.07
View in 3D
