Lineage for d1lvaa3 (1lva A:511-574)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693985Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)
  6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. Species Moorella thermoacetica [TaxId:1525] [74685] (4 PDB entries)
  8. 2693990Domain d1lvaa3: 1lva A:511-574 [74278]
    complexed with so4, y1

Details for d1lvaa3

PDB Entry: 1lva (more details), 2.12 Å

PDB Description: Crystal structure of a C-terminal fragment of Moorella thermoacetica elongation factor SelB
PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d1lvaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
fsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhylvregvlvkindef
ywhr

SCOPe Domain Coordinates for d1lvaa3:

Click to download the PDB-style file with coordinates for d1lvaa3.
(The format of our PDB-style files is described here.)

Timeline for d1lvaa3: