Lineage for d1luva2 (1luv A:84-198)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189935Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2189999Species Human (Homo sapiens) [TaxId:9606] [54724] (30 PDB entries)
  8. 2190028Domain d1luva2: 1luv A:84-198 [74264]
    Other proteins in same PDB: d1luva1, d1luvb1
    complexed with mn

Details for d1luva2

PDB Entry: 1luv (more details), 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1luva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luva2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1luva2:

Click to download the PDB-style file with coordinates for d1luva2.
(The format of our PDB-style files is described here.)

Timeline for d1luva2:

2190028
d1luva2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1luva1