Lineage for d1luva1 (1luv A:1-83)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256628Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1256758Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1256822Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 1256853Domain d1luva1: 1luv A:1-83 [74263]
    Other proteins in same PDB: d1luva2, d1luvb2
    complexed with mn

Details for d1luva1

PDB Entry: 1luv (more details), 1.85 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human manganese superoxide dismutase: insertion of val cgamma into the substrate access channel
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1luva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luva1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1luva1:

Click to download the PDB-style file with coordinates for d1luva1.
(The format of our PDB-style files is described here.)

Timeline for d1luva1:

1256853
d1luva1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1luva2