Lineage for d1luka_ (1luk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1662130Protein Itk/tsk protein tyrosine kinase [82743] (1 species)
  7. 1662131Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)
  8. 1662134Domain d1luka_: 1luk A: [78227]

Details for d1luka_

PDB Entry: 1luk (more details)

PDB Description: nmr structure of the itk sh2 domain, pro287cis, energy minimized average structure
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d1luka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1luka_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg

SCOPe Domain Coordinates for d1luka_:

Click to download the PDB-style file with coordinates for d1luka_.
(The format of our PDB-style files is described here.)

Timeline for d1luka_: