Lineage for d1ltqa1 (1ltq A:153-301)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins)
no insertion subdomainsProtein Polynucleotide kinase, phosphatase domain [82386] (1 species) Species Bacteriophage T4 [TaxId:10665] [82387] (5 PDB entries) 
Domain d1ltqa1: 1ltq A:153-301 [78208]
Other proteins in same PDB: d1ltqa2
complexed with adp, dms
Details for d1ltqa1
PDB Entry: 1ltq (more details), 2.33 Å
PDB Description: crystal structure of t4 polynucleotide kinase
PDB Compounds: (A:) Polynucleotide kinaseSCOPe Domain Sequences for d1ltqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf
SCOPe Domain Coordinates for d1ltqa1:
Click to download the PDB-style file with coordinates for d1ltqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ltqa1:
- d1ltqa1 first appeared in SCOP 1.63
- d1ltqa1 appears in SCOPe 2.07
View in 3D
