Lineage for d1lsta_ (1lst A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521698Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (4 species)
  7. 2521705Species Salmonella typhimurium [TaxId:90371] [53857] (5 PDB entries)
  8. 2521706Domain d1lsta_: 1lst A: [35755]
    complexed with lys

Details for d1lsta_

PDB Entry: 1lst (more details), 1.8 Å

PDB Description: three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
PDB Compounds: (A:) lysine, arginine, ornithine-binding protein

SCOPe Domain Sequences for d1lsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]}
alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk
akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd

SCOPe Domain Coordinates for d1lsta_:

Click to download the PDB-style file with coordinates for d1lsta_.
(The format of our PDB-style files is described here.)

Timeline for d1lsta_: