Lineage for d1lr7a2 (1lr7 A:89-136)
- Root: SCOP 1.75
Class g: Small proteins [56992] (90 folds) 
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) 
conserved core consists of a helix and a loop crosslinked with two disulfidesFamily g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins) 
Protein Domain of follistatin [90166] (1 species)
the C-terminal part of the heparin-binding module, FS1Species Rat (Rattus norvegicus) [TaxId:10116] [90167] (3 PDB entries) 
Domain d1lr7a2: 1lr7 A:89-136 [84680]
Other proteins in same PDB: d1lr7a1
complexed with so4
Details for d1lr7a2
PDB Entry: 1lr7 (more details), 1.5 Å
PDB Description: crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue sucrose octasulphate (sos)
PDB Compounds: (A:) FollistatinSCOP Domain Sequences for d1lr7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]}
capdcsnitwkgpvcgldgktyrnecallkarckeqpelevqyqgkck
SCOP Domain Coordinates for d1lr7a2:
Click to download the PDB-style file with coordinates for d1lr7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lr7a2:
- d1lr7a2 first appeared in SCOP 1.65
- d1lr7a2 appears in SCOP 1.73
- d1lr7a2 appears in SCOPe 2.01
- d1lr7a2 appears in the current release, SCOPe 2.08
View in 3D
