Lineage for d1lqwa_ (1lqw A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily)
alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helixSuperfamily d.167.1: Peptide deformylase [56420] (2 families) 
nickel-dependent enzymeFamily d.167.1.1: Peptide deformylase [56421] (2 proteins)
automatically mapped to Pfam PF01327Protein Peptide deformylase [56422] (11 species) 
Species Staphylococcus aureus [TaxId:1280] [75579] (8 PDB entries)
Uniprot Q9F4L4
Domain d1lqwa_: 1lqw A: [74210]
complexed with zn
Details for d1lqwa_
PDB Entry: 1lqw (more details), 1.87 Å
PDB Description: Crystal Structure of S.aureus Peptide Deformylase
PDB Compounds: (A:) peptide deformylase pdf1SCOPe Domain Sequences for d1lqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqwa_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev
SCOPe Domain Coordinates for d1lqwa_:
Click to download the PDB-style file with coordinates for d1lqwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lqwa_:
- d1lqwa_ first appeared in SCOP 1.61
- d1lqwa_ appears in SCOPe 2.06
- d1lqwa_ appears in the current release, SCOPe 2.08
View in 3D
