Lineage for d1lpla_ (1lpl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784920Protein Cytoskeleton-associated protein F53F4.3 [74926] (1 species)
  7. 2784921Species Nematode (Caenorhabditis elegans) [TaxId:6239] [74927] (2 PDB entries)
    Uniprot Q20728 132-229
  8. 2784923Domain d1lpla_: 1lpl A: [74173]
    structural genomics

Details for d1lpla_

PDB Entry: 1lpl (more details), 1.77 Å

PDB Description: Structural Genomics of Caenorhabditis elegans: CAP-Gly domain of F53F4.3
PDB Compounds: (A:) Hypothetical 25.4 kDa protein F53F4.3 in chromosome V

SCOPe Domain Sequences for d1lpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpla_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sdklneeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkndgs
vagvryfdcdpkyggfvrpvdvkvgdfpelsidei

SCOPe Domain Coordinates for d1lpla_:

Click to download the PDB-style file with coordinates for d1lpla_.
(The format of our PDB-style files is described here.)

Timeline for d1lpla_: