Lineage for d1lp9f2 (1lp9 F:118-245)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029141Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 2029145Domain d1lp9f2: 1lp9 F:118-245 [91089]
    Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b1, d1lp9b2, d1lp9e1, d1lp9f1, d1lp9h1, d1lp9h2, d1lp9i1, d1lp9i2, d1lp9l1, d1lp9m1

Details for d1lp9f2

PDB Entry: 1lp9 (more details), 2 Å

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1
PDB Compounds: (F:) T-cell receptor beta chain

SCOPe Domain Sequences for d1lp9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9f2 b.1.1.2 (F:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d1lp9f2:

Click to download the PDB-style file with coordinates for d1lp9f2.
(The format of our PDB-style files is described here.)

Timeline for d1lp9f2: