SCOPe 2.03: Domain d1lp9f1: 1lp9 F:1-117

Lineage for d1lp9f1 (1lp9 F:1-117)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (29 PDB entries)
Domain d1lp9f1: 1lp9 F:1-117 [91088]
Other proteins in same PDB: d1lp9a1, d1lp9a2, d1lp9b_, d1lp9e2, d1lp9f2, d1lp9h1, d1lp9h2, d1lp9i_, d1lp9l2, d1lp9m2

Details for d1lp9f1

PDB Description: xenoreactive complex ahiii 12.2 tcr bound to p1049/hla-a2.1

PDB Compounds: (F:) T-cell receptor beta chain

SCOPe Domain Sequences for d1lp9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp9f1 b.1.1.1 (F:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi
pdgykasrpsqenfslilelaslsqtavyfcassdwvsyeqyfgpgtrltvle

SCOPe Domain Coordinates for d1lp9f1:

Click to download the PDB-style file with coordinates for d1lp9f1.
(The format of our PDB-style files is described here.)

Timeline for d1lp9f1: