Lineage for d1loxa2 (1lox A:2-112)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) - Protein 15-Lipoxygenase [49728] (1 species)
- Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (1 PDB entry)
Domain d1loxa2: 1lox A:2-112 [23638]
Other proteins in same PDB: d1loxa1
complexed with fe2, rs7
Details for d1loxa2
PDB Entry: 1lox (more details), 2.4 Å
PDB Description: rabbit reticulocyte 15-lipoxygenase
PDB Compounds: (A:) 15-lipoxygenaseSCOPe Domain Sequences for d1loxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1loxa2 b.12.1.1 (A:2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg
SCOPe Domain Coordinates for d1loxa2:
Click to download the PDB-style file with coordinates for d1loxa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1loxa2:
- d1loxa2 first appeared (with stable ids) in SCOP 1.55, called d1lox_2
- d1loxa2 appears in SCOPe 2.05
- d1loxa2 appears in SCOPe 2.07
- d1loxa2 appears in the current release, SCOPe 2.08
View in 3D
