Lineage for d1lotb2 (1lot B:147-373)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883386Protein Actin [53073] (10 species)
  7. 2883430Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2883530Domain d1lotb2: 1lot B:147-373 [74165]
    Other proteins in same PDB: d1lota1, d1lota2, d1lota3
    complexed with atp, ca, gol

Details for d1lotb2

PDB Entry: 1lot (more details), 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1lotb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lotb2 c.55.1.1 (B:147-373) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrk

SCOPe Domain Coordinates for d1lotb2:

Click to download the PDB-style file with coordinates for d1lotb2.
(The format of our PDB-style files is described here.)

Timeline for d1lotb2: