Lineage for d1lnga_ (1lng A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685424Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1685425Superfamily d.201.1: SRP19 [69695] (2 families) (S)
    automatically mapped to Pfam PF01922
  5. 1685426Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 1685427Protein SRP19 [69697] (3 species)
  7. 1685436Species Methanococcus jannaschii [TaxId:2190] [75417] (3 PDB entries)
  8. 1685437Domain d1lnga_: 1lng A: [74045]
    protein/RNA complex; complexed with mg

Details for d1lnga_

PDB Entry: 1lng (more details), 2.3 Å

PDB Description: crystal structure of the srp19-7s.s srp rna complex of m. jannaschii
PDB Compounds: (A:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d1lnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnga_ d.201.1.1 (A:) SRP19 {Methanococcus jannaschii [TaxId: 2190]}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn

SCOPe Domain Coordinates for d1lnga_:

Click to download the PDB-style file with coordinates for d1lnga_.
(The format of our PDB-style files is described here.)

Timeline for d1lnga_: