Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.201: SRP19 [69694] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.201.1: SRP19 [69695] (2 families) automatically mapped to Pfam PF01922 |
Family d.201.1.1: SRP19 [69696] (1 protein) |
Protein SRP19 [69697] (3 species) |
Species Methanococcus jannaschii [TaxId:2190] [75417] (3 PDB entries) |
Domain d1lnga_: 1lng A: [74045] protein/RNA complex; complexed with mg |
PDB Entry: 1lng (more details), 2.3 Å
SCOPe Domain Sequences for d1lnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnga_ d.201.1.1 (A:) SRP19 {Methanococcus jannaschii [TaxId: 2190]} miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei cgcvevdykgnklqllkeickiikgkn
Timeline for d1lnga_: