| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.19: Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81982] (1 family) ![]() |
| Family b.1.19.1: Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81983] (1 protein) |
| Protein Antigen MPT63/MPB63 (immunoprotective extracellular protein) [81984] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [81985] (1 PDB entry) |
| Domain d1lmia_: 1lmi A: [78098] |
PDB Entry: 1lmi (more details), 1.5 Å
SCOP Domain Sequences for d1lmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmia_ b.1.19.1 (A:) Antigen MPT63/MPB63 (immunoprotective extracellular protein) {Mycobacterium tuberculosis [TaxId: 1773]}
saypitgklgseltmtdtvgqvvlgwkvsdlksstavipgypvagqvweatatvnairgs
vtpavsqfnartadginyrvlwqaagpdtisgatipqgeqstgkiyfdvtgpsptivamn
ngmedlliwep
Timeline for d1lmia_: