Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein Elongin C [54699] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (8 PDB entries) |
Domain d1lm8c_: 1lm8 C: [74034] Other proteins in same PDB: d1lm8b_, d1lm8v_ complexed with hyp |
PDB Entry: 1lm8 (more details), 1.85 Å
SCOP Domain Sequences for d1lm8c_:
Sequence, based on SEQRES records: (download)
>d1lm8c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d1lm8c_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpnevnfreipshvlskvcmyftykvryt nssteipefpiapeialellmaanfldc
Timeline for d1lm8c_: