Lineage for d1lkka_ (1lkk A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868294Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 868295Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 868296Family d.93.1.1: SH2 domain [55551] (34 proteins)
    Pfam PF00017
  6. 868515Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 868516Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)
  8. 868517Domain d1lkka_: 1lkk A: [40412]
    complexed with phs

Details for d1lkka_

PDB Entry: 1lkk (more details), 1 Å

PDB Description: human p56-lck tyrosine kinase sh2 domain in complex with the phosphotyrosyl peptide ac-ptyr-glu-glu-ile (pyeei peptide)
PDB Compounds: (A:) human p56 tyrosine kinase

SCOP Domain Sequences for d1lkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhy
kirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1lkka_:

Click to download the PDB-style file with coordinates for d1lkka_.
(The format of our PDB-style files is described here.)

Timeline for d1lkka_: