Lineage for d1lk9b_ (1lk9 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) 
Protein Alliinase [82482] (1 species)
cysteine sulphoxide lyaseSpecies Garlic (Allium sativum) [TaxId:4682] [82483] (1 PDB entry) 
Domain d1lk9b_: 1lk9 B: [78058]
complexed with cl, dha, epe, plp, so4
Details for d1lk9b_
PDB Entry: 1lk9 (more details), 1.53 Å
PDB Description: the three-dimensional structure of alliinase from garlic
PDB Compounds: (B:) alliin lyaseSCOPe Domain Sequences for d1lk9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk9b_ c.67.1.1 (B:) Alliinase {Garlic (Allium sativum) [TaxId: 4682]}
kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
mvkakrk
SCOPe Domain Coordinates for d1lk9b_:
Click to download the PDB-style file with coordinates for d1lk9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lk9b_:
- d1lk9b_ first appeared in SCOP 1.63
- d1lk9b_ appears in SCOPe 2.06
- d1lk9b_ appears in the current release, SCOPe 2.08
View in 3D
