Lineage for d1ljya2 (1ljy A:240-307)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) 
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
secreted during involution
Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries) 
Domain d1ljya2: 1ljy A:240-307 [84619]
Other proteins in same PDB: d1ljya1
complexed with nag, ndg
Details for d1ljya2
PDB Entry: 1ljy (more details), 2.9 Å
PDB Description: crystal structure of a novel regulatory 40 kda mammary gland protein (mgp-40) secreted during involution
PDB Compounds: (A:) mgp-40SCOPe Domain Sequences for d1ljya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljya2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay
SCOPe Domain Coordinates for d1ljya2:
Click to download the PDB-style file with coordinates for d1ljya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ljya2:
- d1ljya2 first appeared in SCOP 1.65
- d1ljya2 appears in SCOPe 2.06
- d1ljya2 appears in the current release, SCOPe 2.08
View in 3D
