Lineage for d1ljya1 (1ljy A:1-239,A:308-362)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570170Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1570348Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 1570360Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries)
  8. 1570367Domain d1ljya1: 1ljy A:1-239,A:308-362 [84618]
    Other proteins in same PDB: d1ljya2
    complexed with nag, ndg

Details for d1ljya1

PDB Entry: 1ljy (more details), 2.9 Å

PDB Description: crystal structure of a novel regulatory 40 kda mammary gland protein (mgp-40) secreted during involution
PDB Compounds: (A:) mgp-40

SCOPe Domain Sequences for d1ljya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljya1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

SCOPe Domain Coordinates for d1ljya1:

Click to download the PDB-style file with coordinates for d1ljya1.
(The format of our PDB-style files is described here.)

Timeline for d1ljya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ljya2