Lineage for d1ljta_ (1ljt A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)
  8. Domain d1ljta_: 1ljt A: [78053]
    complexed with hdi

Details for d1ljta_

PDB Entry: 1ljt (more details), 2 Å

PDB Description: Crystal Structure of Macrophage Migration Inhibitory Factor complexed with (S,R)-3-(4-hydroxyphenyl)-4,5-dihydro-5-isoxazole-acetic acid methyl ester (ISO-1)
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d1ljta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljta_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d1ljta_ are not available.

Timeline for d1ljta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ljtb_, d1ljtc_