Lineage for d1lj8a3 (1lj8 A:287-492)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276460Family a.100.1.9: Mannitol 2-dehydrogenase [81843] (1 protein)
  6. 1276461Protein Mannitol 2-dehydrogenase [81844] (1 species)
  7. 1276462Species Pseudomonas fluorescens [TaxId:294] [81845] (2 PDB entries)
  8. 1276463Domain d1lj8a3: 1lj8 A:287-492 [90392]
    Other proteins in same PDB: d1lj8a4
    complexed with nad

Details for d1lj8a3

PDB Entry: 1lj8 (more details), 1.7 Å

PDB Description: Crystal structure of mannitol dehydrogenase in complex with NAD
PDB Compounds: (A:) mannitol dehydrogenase

SCOPe Domain Sequences for d1lj8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lj8a3 a.100.1.9 (A:287-492) Mannitol 2-dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
dvtpyeemkigllngshlaltylgflkgyrfvhetmndplfvaymraymdldvtpnlapv
pgidltdykqtlvdrfsnqaiadqlervcsdgsskfpkftvptinrliadgreteraalv
vaawalylkgvdengvsytipdpraefcqglvsddalisqrllaveeifgtaipnspefv
aafercygslrdngvtttlkhllkkp

SCOPe Domain Coordinates for d1lj8a3:

Click to download the PDB-style file with coordinates for d1lj8a3.
(The format of our PDB-style files is described here.)

Timeline for d1lj8a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lj8a4