Lineage for d1lila2 (1lil A:108-215)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) 
Domain d1lila2: 1lil A:108-215 [21466]
Other proteins in same PDB: d1lila1, d1lilb1
part of Bence-Jones protein CLE
Details for d1lila2
PDB Entry: 1lil (more details), 2.65 Å
PDB Description: bence jones protein cle, a lambda iii immunoglobulin light-chain dimer
PDB Compounds: (A:) lambda III bence jones protein cleSCOPe Domain Sequences for d1lila2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lila2 b.1.1.2 (A:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
SCOPe Domain Coordinates for d1lila2:
Click to download the PDB-style file with coordinates for d1lila2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lila2:
- d1lila2 first appeared (with stable ids) in SCOP 1.55
- d1lila2 appears in SCOPe 2.03
- d1lila2 appears in SCOPe 2.05
- d1lila2 appears in the current release, SCOPe 2.08
View in 3D
