Lineage for d1lida_ (1lid A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804902Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)
  8. 2804912Domain d1lida_: 1lid A: [27184]
    complexed with ola

Details for d1lida_

PDB Entry: 1lid (more details), 1.6 Å

PDB Description: the adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
PDB Compounds: (A:) adipocyte lipid-binding protein

SCOPe Domain Sequences for d1lida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lida_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d1lida_:

Click to download the PDB-style file with coordinates for d1lida_.
(The format of our PDB-style files is described here.)

Timeline for d1lida_: