Lineage for d1li4a1 (1li4 A:190-352)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
this domain interrupts the other domain which defines family
Protein S-adenosylhomocystein hydrolase [51845] (3 species) Species Human (Homo sapiens) [TaxId:9606] [51846] (3 PDB entries) 
Domain d1li4a1: 1li4 A:190-352 [84616]
Other proteins in same PDB: d1li4a2
complexed with ipa, nad, noc
Details for d1li4a1
PDB Entry: 1li4 (more details), 2.01 Å
PDB Description: Human S-adenosylhomocysteine hydrolase complexed with neplanocin
PDB Compounds: (A:) s-adenosylhomocysteine hydrolaseSCOPe Domain Sequences for d1li4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}
dnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpina
lqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdveidvk
wlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamg
SCOPe Domain Coordinates for d1li4a1:
Click to download the PDB-style file with coordinates for d1li4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1li4a1:
- d1li4a1 first appeared in SCOP 1.65
- d1li4a1 appears in SCOPe 2.05
- d1li4a1 appears in SCOPe 2.07
- d1li4a1 appears in the current release, SCOPe 2.08
View in 3D
