Lineage for d1li1f2 (1li1 F:115-229)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002102Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 3002103Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 3002189Species Human (Homo sapiens) [TaxId:9606] [75587] (5 PDB entries)
  8. 3002201Domain d1li1f2: 1li1 F:115-229 [73909]
    alpha 1 (chains A,B,D and E) and alpha 2 (chains C and F) isoforms
    complexed with act

Details for d1li1f2

PDB Entry: 1li1 (more details), 1.9 Å

PDB Description: The 1.9-A crystal structure of the noncollagenous (NC1) domain of human placenta collagen IV shows stabilization via a novel type of covalent Met-Lys cross-link
PDB Compounds: (F:) Collagen alpha 2(IV)

SCOPe Domain Sequences for d1li1f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li1f2 d.169.1.6 (F:115-229) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
aiaiavhsqdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfi
ecnggrgtchyyankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmknl

SCOPe Domain Coordinates for d1li1f2:

Click to download the PDB-style file with coordinates for d1li1f2.
(The format of our PDB-style files is described here.)

Timeline for d1li1f2: