Lineage for d1lfoa_ (1lfo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805152Protein Liver fatty acid binding protein [50866] (3 species)
  7. 2805187Species Norway rat (Rattus norvegicus) [TaxId:10116] [50867] (4 PDB entries)
  8. 2805188Domain d1lfoa_: 1lfo A: [27223]
    complexed with beo, ola, unx

Details for d1lfoa_

PDB Entry: 1lfo (more details), 2.3 Å

PDB Description: liver fatty acid binding protein-oleate complex
PDB Compounds: (A:) liver fatty acid binding protein

SCOPe Domain Sequences for d1lfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfoa_ b.60.1.2 (A:) Liver fatty acid binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mnfsgkyqvqsqenfepfmkamglpedliqkgkdikgvseivhegkkvkltitygskvih
neftlgeeceletmtgekvkavvkmegdnkmvttfkgiksvtefngdtitntmtlgdivy
krvskri

SCOPe Domain Coordinates for d1lfoa_:

Click to download the PDB-style file with coordinates for d1lfoa_.
(The format of our PDB-style files is described here.)

Timeline for d1lfoa_: