Lineage for d1lfaa_ (1lfa A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) 
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
Uniprot P20701 153-334
Domain d1lfaa_: 1lfa A: [34122]
complexed with cl, mn
Details for d1lfaa_
PDB Entry: 1lfa (more details), 1.8 Å
PDB Description: cd11a i-domain with bound mn++
PDB Compounds: (A:) cd11aSCOPe Domain Sequences for d1lfaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lfaa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie
SCOPe Domain Coordinates for d1lfaa_:
Click to download the PDB-style file with coordinates for d1lfaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lfaa_:
- d1lfaa_ first appeared (with stable ids) in SCOP 1.55
- d1lfaa_ appears in SCOPe 2.07
View in 3D
