Lineage for d1leha1 (1leh A:135-364)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
Protein Leucine dehydrogenase [51890] (1 species) Species Bacillus sphaericus [TaxId:1421] [51891] (1 PDB entry) 
Domain d1leha1: 1leh A:135-364 [30268]
Other proteins in same PDB: d1leha2, d1lehb2
has additional insertions and/or extensions that are not grouped together
Details for d1leha1
PDB Entry: 1leh (more details), 2.2 Å
PDB Description: leucine dehydrogenase from bacillus sphaericus
PDB Compounds: (A:) leucine dehydrogenaseSCOPe Domain Sequences for d1leha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]}
gispafgssgnpspvtaygvyrgmkaaakeafgsdsleglavsvqglgnvakalckklnt
egaklvvtdvnkaavsaavaeegadavapnaiygvtcdifapcalgavlndftipqlkak
viagsadnqlkdprhgkylhelgivyapdyvinaggvinvadelygynrtramkrvdgiy
dsiekifaiskrdgvpsyvaadrmaeeriakvakarsqflqdqrnilngr
SCOPe Domain Coordinates for d1leha1:
Click to download the PDB-style file with coordinates for d1leha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1leha1:
- d1leha1 first appeared (with stable ids) in SCOP 1.55
- d1leha1 appears in SCOPe 2.07
View in 3D
