Lineage for d1lcua2 (1lcu A:158-385)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Actin [53073] (10 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
Uniprot P02568 ! SQ 02568
Domain d1lcua2: 1lcu A:158-385 [73831]
complexed with atp, ca, cl, lar
Details for d1lcua2
PDB Entry: 1lcu (more details), 3.5 Å
PDB Description: polylysine induces an antiparallel actin dimer that nucleates filament assembly: crystal structure at 3.5 a resolution
PDB Compounds: (A:) Actin, alpha skeletal muscleSCOPe Domain Sequences for d1lcua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lcua2 c.55.1.1 (A:158-385) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaere
ivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsfi
gmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmki
kiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
SCOPe Domain Coordinates for d1lcua2:
Click to download the PDB-style file with coordinates for d1lcua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lcua2:
- d1lcua2 first appeared in SCOP 1.61
- d1lcua2 appears in SCOPe 2.07
View in 3D
