Lineage for d1lcka2 (1lck A:117-226)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572140Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 2572141Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries)
  8. 2572152Domain d1lcka2: 1lck A:117-226 [40421]
    Other proteins in same PDB: d1lcka1

Details for d1lcka2

PDB Entry: 1lck (more details), 2.5 Å

PDB Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa
PDB Compounds: (A:) p56==lck== tyrosine kinase

SCOPe Domain Sequences for d1lcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcka2 d.93.1.1 (A:117-226) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
akanslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqge
vvkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOPe Domain Coordinates for d1lcka2:

Click to download the PDB-style file with coordinates for d1lcka2.
(The format of our PDB-style files is described here.)

Timeline for d1lcka2: