Lineage for d1lb2a1 (1lb2 A:138-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906094Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)
  6. 906095Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 906096Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)
  8. 906125Domain d1lb2a1: 1lb2 A:138-209 [77869]
    Other proteins in same PDB: d1lb2a2, d1lb2b_, d1lb2e_
    protein/DNA complex; protein/RNA complex; complexed with cmp

Details for d1lb2a1

PDB Entry: 1lb2 (more details), 3.1 Å

PDB Description: Structure of the E. coli alpha C-terminal domain of RNA polymerase in complex with CAP and DNA
PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1lb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lb2a1 a.4.5.4 (A:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

SCOPe Domain Coordinates for d1lb2a1:

Click to download the PDB-style file with coordinates for d1lb2a1.
(The format of our PDB-style files is described here.)

Timeline for d1lb2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lb2a2