Lineage for d1lafe_ (1laf E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162711Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (1 species)
  7. 2162712Species Salmonella typhimurium [TaxId:90371] [53857] (5 PDB entries)
  8. 2162714Domain d1lafe_: 1laf E: [35756]
    complexed with arg

Details for d1lafe_

PDB Entry: 1laf (more details), 2.06 Å

PDB Description: structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
PDB Compounds: (E:) lysine, arginine, ornithine-binding protein

SCOPe Domain Sequences for d1lafe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lafe_ c.94.1.1 (E:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]}
alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk
akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd

SCOPe Domain Coordinates for d1lafe_:

Click to download the PDB-style file with coordinates for d1lafe_.
(The format of our PDB-style files is described here.)

Timeline for d1lafe_: