![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries) Uniprot P11846 |
![]() | Domain d1l9bh1: 1l9b H:36-253 [73712] Other proteins in same PDB: d1l9bc_, d1l9bh2, d1l9bl_, d1l9bm_ complexed with bcl, bph, cl, fe2, hem, hto, lda, na, u10 |
PDB Entry: 1l9b (more details), 2.4 Å
SCOPe Domain Sequences for d1l9bh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l9bh1 b.41.1.1 (H:36-253) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvva
Timeline for d1l9bh1: