Lineage for d1l8qa2 (1l8q A:77-289)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
contains TrpR-like DNA-binding domain after the family specific domainsSpecies Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries) 
Domain d1l8qa2: 1l8q A:77-289 [77810]
Other proteins in same PDB: d1l8qa1
complexed with adp, mg
Details for d1l8qa2
PDB Entry: 1l8q (more details), 2.7 Å
PDB Description: crystal structure of dna replication initiation factor
PDB Compounds: (A:) Chromosomal replication initiator protein dnaASCOPe Domain Sequences for d1l8qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk
SCOPe Domain Coordinates for d1l8qa2:
Click to download the PDB-style file with coordinates for d1l8qa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8qa2:
- d1l8qa2 first appeared in SCOP 1.63
- d1l8qa2 appears in SCOP 1.75
- d1l8qa2 appears in SCOPe 2.02
- d1l8qa2 appears in the current release, SCOPe 2.08
View in 3D
