![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Chromosomal replication initiation factor DnaA [82416] (1 species) contains TrpR-like DNA-binding domain after the family specific domains |
![]() | Species Aquifex aeolicus [TaxId:63363] [82417] (2 PDB entries) |
![]() | Domain d1l8qa2: 1l8q A:77-289 [77810] Other proteins in same PDB: d1l8qa1 complexed with adp, mg |
PDB Entry: 1l8q (more details), 2.7 Å
SCOPe Domain Sequences for d1l8qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke fnlelrkevidyllentknvreiegkikliklk
Timeline for d1l8qa2: