Lineage for d1l8bb_ (1l8b B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.86: eIF4e-like [55417] (1 superfamily)
beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478Superfamily d.86.1: eIF4e-like [55418] (3 families) 
Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
automatically mapped to Pfam PF01652Protein Translation initiation factor eIF4e [55420] (3 species)
messenger RNA 5' cap-binding protein
Species Mouse (Mus musculus) [TaxId:10090] [55421] (24 PDB entries) 
Domain d1l8bb_: 1l8b B: [73684]
complexed with mgp
Details for d1l8bb_
PDB Entry: 1l8b (more details), 1.8 Å
PDB Description: cocrystal structure of the messenger rna 5' cap-binding protein (eif4e) bound to 7-methylgpppg
PDB Compounds: (B:) eukaryotic translation initiation factor 4eSCOPe Domain Sequences for d1l8bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l8bb_ d.86.1.1 (B:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
gsttknrfvv
SCOPe Domain Coordinates for d1l8bb_:
Click to download the PDB-style file with coordinates for d1l8bb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l8bb_:
- d1l8bb_ first appeared in SCOP 1.61
- d1l8bb_ appears in SCOPe 2.07
View in 3D
