![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins) Pfam PF05448; AXE1 |
![]() | Protein Cephalosporin C deacetylase [82505] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries) |
![]() | Domain d1l7aa_: 1l7a A: [77772] structural genomics CASP5 |
PDB Entry: 1l7a (more details), 1.5 Å
SCOPe Domain Sequences for d1l7aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq qrsedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg sqgggltiaaaalsdipkaavadypylsnferaidvaleqpyleinsffrrngspetevq amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey ipafqteklaffkqilkg
Timeline for d1l7aa_: