Lineage for d1l6sa_ (1l6s A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structure
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
hybrid of classes I and II aldolase
automatically mapped to Pfam PF00490
Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species) 
Species Escherichia coli [TaxId:562] [51598] (4 PDB entries) 
Domain d1l6sa_: 1l6s A: [73627]
complexed with dsb, mg, zn
Details for d1l6sa_
PDB Entry: 1l6s (more details), 1.7 Å
PDB Description: Crystal Structure of Porphobilinogen Synthase Complexed with the Inhibitor 4,7-Dioxosebacic Acid
PDB Compounds: (A:) porphobilinogen synthaseSCOPe Domain Sequences for d1l6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr
SCOPe Domain Coordinates for d1l6sa_:
Click to download the PDB-style file with coordinates for d1l6sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l6sa_:
- d1l6sa_ first appeared in SCOP 1.61
- d1l6sa_ appears in SCOPe 2.06
- d1l6sa_ appears in the current release, SCOPe 2.08
View in 3D
