Lineage for d1l6oa_ (1l6o A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786061Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 1786062Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)
  8. 1786067Domain d1l6oa_: 1l6o A: [84534]
    complexed with a peptide from Daper 1, chains D, E and F

Details for d1l6oa_

PDB Entry: 1l6o (more details), 2.2 Å

PDB Description: xenopus dishevelled pdz domain
PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d1l6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6oa_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhh

SCOPe Domain Coordinates for d1l6oa_:

Click to download the PDB-style file with coordinates for d1l6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1l6oa_: