Lineage for d1l6na2 (1l6n A:131-289)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries) 
Domain d1l6na2: 1l6n A:131-289 [73625]
Other proteins in same PDB: d1l6na1
Details for d1l6na2
PDB Entry: 1l6n (more details)
PDB Description: structure of the n-terminal 283-residue fragment of the hiv-1 gag polyprotein
PDB Compounds: (A:) gag polyproteinSCOPe Domain Sequences for d1l6na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6na2 a.73.1.1 (A:131-289) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
nypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnt
vgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwm
thnppipvgeiykrwiilglnkivrmysptsilhhhhhh
SCOPe Domain Coordinates for d1l6na2:
Click to download the PDB-style file with coordinates for d1l6na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l6na2:
- d1l6na2 first appeared in SCOP 1.61
- d1l6na2 appears in SCOPe 2.02
- d1l6na2 appears in SCOPe 2.04
- d1l6na2 appears in the current release, SCOPe 2.08
View in 3D
