Lineage for d1l5ya_ (1l5y A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species) Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries) 
Domain d1l5ya_: 1l5y A: [77720]
also includes a part of the linker region
complexed with bef, bf2, bf4, gol, mg, so4
Details for d1l5ya_
PDB Entry: 1l5y (more details), 2.1 Å
PDB Description: crystal structure of mg2+ / bef3-bound receiver domain of sinorhizobium meliloti dctd
PDB Compounds: (A:) c4-dicarboxylate transport transcriptional regulatory protein dctdSCOPe Domain Sequences for d1l5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5ya_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
psvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgmdgl
alfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraekkrr
lvmenrslrraaeaaseglklaa
SCOPe Domain Coordinates for d1l5ya_:
Click to download the PDB-style file with coordinates for d1l5ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l5ya_:
- d1l5ya_ first appeared in SCOP 1.63
- d1l5ya_ appears in SCOPe 2.04
- d1l5ya_ is called d1l5ya1 in SCOPe 2.06
- d1l5ya_ appears in the current release, SCOPe 2.08, called d1l5ya1
View in 3D
