Lineage for d1l4ia2 (1l4i A:121-205)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) 
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) 
Protein SfaE [74881] (1 species) Species Escherichia coli [TaxId:562] [74882] (1 PDB entry) 
Domain d1l4ia2: 1l4i A:121-205 [73565]
Other proteins in same PDB: d1l4ia1, d1l4ib1
Details for d1l4ia2
PDB Entry: 1l4i (more details), 2.2 Å
PDB Description: Crystal Structure of the Periplasmic Chaperone SfaE
PDB Compounds: (A:) SfaE PROTEINSCOPe Domain Sequences for d1l4ia2:
Sequence, based on SEQRES records: (download)
>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftrenggltlfnptpyyltvtdlkagnkslentmvppqgkvtvnipgg
ytggdityktindygalteqvrgvv
Sequence, based on observed residues (ATOM records): (download)
>d1l4ia2 b.7.2.1 (A:121-205) SfaE {Escherichia coli [TaxId: 562]}
vippeqapgkleftreltlfnptpyyltvtdlkagnkslentmvppqgkvtvniggdity
ktindygalteqvrgvv
SCOPe Domain Coordinates for d1l4ia2:
Click to download the PDB-style file with coordinates for d1l4ia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l4ia2:
- d1l4ia2 first appeared in SCOP 1.61
- d1l4ia2 appears in SCOPe 2.07
View in 3D
